Anti COX7A2L pAb (ATL-HPA059124)

Atlas Antibodies

SKU: ATL-HPA059124-25

• 

Protein Description: cytochrome c oxidase subunit VIIa polypeptide 2 like
Gene Name: COX7A2L
Alternative Gene Name: COX7AR, COX7RP, EB1, SIG81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024248: 85%, ENSRNOG00000004526: 58%
Entrez Gene ID: 9167
Uniprot ID: O14548
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVY
• Gene Sequence: YKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVY
• Gene ID - Mouse: ENSMUSG00000024248
• Gene ID - Rat: ENSRNOG00000004526
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.