Protein Description: cytochrome c oxidase assembly homolog 15 (yeast)
Gene Name: COX15
Alternative Gene Name: CEMCOX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040018: 90%, ENSRNOG00000017230: 93%
Entrez Gene ID: 1355
Uniprot ID: Q7KZN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COX15
Alternative Gene Name: CEMCOX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040018: 90%, ENSRNOG00000017230: 93%
Entrez Gene ID: 1355
Uniprot ID: Q7KZN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MGESWIPEDLFTFSPILRNVFENPTMVQFD |
| Documents & Links for Anti COX15 pAb (ATL-HPA066096) | |
| Datasheet | Anti COX15 pAb (ATL-HPA066096) Datasheet (External Link) |
| Vendor Page | Anti COX15 pAb (ATL-HPA066096) at Atlas |
| Documents & Links for Anti COX15 pAb (ATL-HPA066096) | |
| Datasheet | Anti COX15 pAb (ATL-HPA066096) Datasheet (External Link) |
| Vendor Page | Anti COX15 pAb (ATL-HPA066096) |