Anti CORO1A pAb (ATL-HPA051132 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051132-25

• 
• 
• 

Protein Description: coronin, actin binding protein, 1A
Gene Name: CORO1A
Alternative Gene Name: coronin-1, HCORO1, p57
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030707: 80%, ENSRNOG00000019430: 76%
Entrez Gene ID: 11151
Uniprot ID: P31146
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQA
• Gene Sequence: RELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQA
• Gene ID - Mouse: ENSMUSG00000030707
• Gene ID - Rat: ENSRNOG00000019430
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.