Anti COQ2 pAb (ATL-HPA056599 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA056599-100
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
  • Western blot analysis using Anti-COQ2 antibody HPA056599 (A) shows similar pattern to independent antibody HPA068727 (B).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
Gene Name: COQ2
Alternative Gene Name: CL640, FLJ26072
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029319: 77%, ENSRNOG00000002194: 77%
Entrez Gene ID: 27235
Uniprot ID: Q96H96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSGQTAPYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFI
Gene Sequence NSGQTAPYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFI
Gene ID - Mouse ENSMUSG00000029319
Gene ID - Rat ENSRNOG00000002194
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COQ2 pAb (ATL-HPA056599 w/enhanced validation)
Datasheet Anti COQ2 pAb (ATL-HPA056599 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COQ2 pAb (ATL-HPA056599 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti COQ2 pAb (ATL-HPA056599 w/enhanced validation)
Datasheet Anti COQ2 pAb (ATL-HPA056599 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COQ2 pAb (ATL-HPA056599 w/enhanced validation)