Anti COQ10B pAb (ATL-HPA046057)

Atlas Antibodies

SKU:
ATL-HPA046057-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coenzyme Q10 homolog B (S. cerevisiae)
Gene Name: COQ10B
Alternative Gene Name: FLJ13448
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025981: 61%, ENSRNOG00000014456: 64%
Entrez Gene ID: 80219
Uniprot ID: Q9H8M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRK
Gene Sequence ARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRK
Gene ID - Mouse ENSMUSG00000025981
Gene ID - Rat ENSRNOG00000014456
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COQ10B pAb (ATL-HPA046057)
Datasheet Anti COQ10B pAb (ATL-HPA046057) Datasheet (External Link)
Vendor Page Anti COQ10B pAb (ATL-HPA046057) at Atlas Antibodies

Documents & Links for Anti COQ10B pAb (ATL-HPA046057)
Datasheet Anti COQ10B pAb (ATL-HPA046057) Datasheet (External Link)
Vendor Page Anti COQ10B pAb (ATL-HPA046057)