Anti COPS5 pAb (ATL-HPA051531)
Atlas Antibodies
- SKU:
- ATL-HPA051531-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: COPS5
Alternative Gene Name: CSN5, JAB1, MOV-34, SGN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025917: 100%, ENSRNOG00000006499: 100%
Entrez Gene ID: 10987
Uniprot ID: Q92905
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL |
Gene Sequence | FQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL |
Gene ID - Mouse | ENSMUSG00000025917 |
Gene ID - Rat | ENSRNOG00000006499 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COPS5 pAb (ATL-HPA051531) | |
Datasheet | Anti COPS5 pAb (ATL-HPA051531) Datasheet (External Link) |
Vendor Page | Anti COPS5 pAb (ATL-HPA051531) at Atlas Antibodies |
Documents & Links for Anti COPS5 pAb (ATL-HPA051531) | |
Datasheet | Anti COPS5 pAb (ATL-HPA051531) Datasheet (External Link) |
Vendor Page | Anti COPS5 pAb (ATL-HPA051531) |