Anti COPS3 pAb (ATL-HPA050557)

Atlas Antibodies

SKU:
ATL-HPA050557-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: COP9 signalosome subunit 3
Gene Name: COPS3
Alternative Gene Name: CSN3, SGN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019373: 99%, ENSRNOG00000053943: 99%
Entrez Gene ID: 8533
Uniprot ID: Q9UNS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRGIGILKQAIDKMQMNTNQLTSIHADLCQLCLLAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFERALYFYEQAITTPAM
Gene Sequence LRGIGILKQAIDKMQMNTNQLTSIHADLCQLCLLAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFERALYFYEQAITTPAM
Gene ID - Mouse ENSMUSG00000019373
Gene ID - Rat ENSRNOG00000053943
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COPS3 pAb (ATL-HPA050557)
Datasheet Anti COPS3 pAb (ATL-HPA050557) Datasheet (External Link)
Vendor Page Anti COPS3 pAb (ATL-HPA050557) at Atlas Antibodies

Documents & Links for Anti COPS3 pAb (ATL-HPA050557)
Datasheet Anti COPS3 pAb (ATL-HPA050557) Datasheet (External Link)
Vendor Page Anti COPS3 pAb (ATL-HPA050557)