Protein Description: coatomer protein complex, subunit beta 1
Gene Name: COPB1
Alternative Gene Name: COPB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030754: 98%, ENSRNOG00000057623: 97%
Entrez Gene ID: 1315
Uniprot ID: P53618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COPB1
Alternative Gene Name: COPB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030754: 98%, ENSRNOG00000057623: 97%
Entrez Gene ID: 1315
Uniprot ID: P53618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKT |
| Documents & Links for Anti COPB1 pAb (ATL-HPA064403) | |
| Datasheet | Anti COPB1 pAb (ATL-HPA064403) Datasheet (External Link) |
| Vendor Page | Anti COPB1 pAb (ATL-HPA064403) at Atlas |
| Documents & Links for Anti COPB1 pAb (ATL-HPA064403) | |
| Datasheet | Anti COPB1 pAb (ATL-HPA064403) Datasheet (External Link) |
| Vendor Page | Anti COPB1 pAb (ATL-HPA064403) |