Anti COMMD5 pAb (ATL-HPA046905)

Atlas Antibodies

SKU:
ATL-HPA046905-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: COMM domain containing 5
Gene Name: COMMD5
Alternative Gene Name: FLJ13008, HCaRG, HT002
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055041: 73%, ENSRNOG00000050582: 73%
Entrez Gene ID: 28991
Uniprot ID: Q9GZQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADF
Gene Sequence TFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADF
Gene ID - Mouse ENSMUSG00000055041
Gene ID - Rat ENSRNOG00000050582
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COMMD5 pAb (ATL-HPA046905)
Datasheet Anti COMMD5 pAb (ATL-HPA046905) Datasheet (External Link)
Vendor Page Anti COMMD5 pAb (ATL-HPA046905) at Atlas Antibodies

Documents & Links for Anti COMMD5 pAb (ATL-HPA046905)
Datasheet Anti COMMD5 pAb (ATL-HPA046905) Datasheet (External Link)
Vendor Page Anti COMMD5 pAb (ATL-HPA046905)