Anti COMMD10 pAb (ATL-HPA045441)

Atlas Antibodies

SKU:
ATL-HPA045441-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: COMM domain containing 10
Gene Name: COMMD10
Alternative Gene Name: PTD002
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042705: 87%, ENSRNOG00000003958: 89%
Entrez Gene ID: 51397
Uniprot ID: Q9Y6G5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFY
Gene Sequence QETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFY
Gene ID - Mouse ENSMUSG00000042705
Gene ID - Rat ENSRNOG00000003958
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COMMD10 pAb (ATL-HPA045441)
Datasheet Anti COMMD10 pAb (ATL-HPA045441) Datasheet (External Link)
Vendor Page Anti COMMD10 pAb (ATL-HPA045441) at Atlas Antibodies

Documents & Links for Anti COMMD10 pAb (ATL-HPA045441)
Datasheet Anti COMMD10 pAb (ATL-HPA045441) Datasheet (External Link)
Vendor Page Anti COMMD10 pAb (ATL-HPA045441)