Anti COLQ pAb (ATL-HPA045876)

Atlas Antibodies

SKU:
ATL-HPA045876-25
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cell junctions.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
Gene Name: COLQ
Alternative Gene Name: EAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057606: 89%, ENSRNOG00000019615: 84%
Entrez Gene ID: 8292
Uniprot ID: Q9Y215
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPGRCLCGPTMNVNNPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLTPFYPVDYTA
Gene Sequence PPGRCLCGPTMNVNNPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLTPFYPVDYTA
Gene ID - Mouse ENSMUSG00000057606
Gene ID - Rat ENSRNOG00000019615
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COLQ pAb (ATL-HPA045876)
Datasheet Anti COLQ pAb (ATL-HPA045876) Datasheet (External Link)
Vendor Page Anti COLQ pAb (ATL-HPA045876) at Atlas Antibodies

Documents & Links for Anti COLQ pAb (ATL-HPA045876)
Datasheet Anti COLQ pAb (ATL-HPA045876) Datasheet (External Link)
Vendor Page Anti COLQ pAb (ATL-HPA045876)