Anti COLGALT1 pAb (ATL-HPA047821)

Atlas Antibodies

SKU:
ATL-HPA047821-25
  • Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
  • Western blot analysis in human cell line U-138MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: collagen beta(1-O)galactosyltransferase 1
Gene Name: COLGALT1
Alternative Gene Name: FLJ22329, GLT25D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034807: 90%, ENSRNOG00000023317: 88%
Entrez Gene ID: 79709
Uniprot ID: Q8NBJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAFSCKQAEVQMYVCNKEEYGFLPVPLRAHSTLQDEAESFMHVQLEVMVKHPPAEPSRFISAPTKTPD
Gene Sequence FAFSCKQAEVQMYVCNKEEYGFLPVPLRAHSTLQDEAESFMHVQLEVMVKHPPAEPSRFISAPTKTPD
Gene ID - Mouse ENSMUSG00000034807
Gene ID - Rat ENSRNOG00000023317
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COLGALT1 pAb (ATL-HPA047821)
Datasheet Anti COLGALT1 pAb (ATL-HPA047821) Datasheet (External Link)
Vendor Page Anti COLGALT1 pAb (ATL-HPA047821) at Atlas Antibodies

Documents & Links for Anti COLGALT1 pAb (ATL-HPA047821)
Datasheet Anti COLGALT1 pAb (ATL-HPA047821) Datasheet (External Link)
Vendor Page Anti COLGALT1 pAb (ATL-HPA047821)