Anti COL8A2 pAb (ATL-HPA049788)

Atlas Antibodies

SKU: ATL-HPA049788-25

• 

Protein Description: collagen, type VIII, alpha 2
Gene Name: COL8A2
Alternative Gene Name: FECD, FECD1, PPCD, PPCD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056174: 95%, ENSRNOG00000010841: 95%
Entrez Gene ID: 1296
Uniprot ID: P25067
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: GYAPVKYIQPMQKGPVGPPFREGKGQYLEMPLPLLPMDLKG
• Gene ID - Mouse: ENSMUSG00000056174
• Gene ID - Rat: ENSMUSG00000056174
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.