Anti COL8A1 pAb (ATL-HPA053107 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053107-25

• 

Protein Description: collagen, type VIII, alpha 1
Gene Name: COL8A1
Alternative Gene Name: C3orf7, MGC9568
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068196: 93%, ENSRNOG00000039668: 93%
Entrez Gene ID: 1295
Uniprot ID: P27658
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQ
• Gene Sequence: QGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQ
• Gene ID - Mouse: ENSMUSG00000068196
• Gene ID - Rat: ENSRNOG00000039668
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COL8A1 pAb (ATL-HPA053107 w/enhanced validation) – 1 Found

Corominas, Jordi; Colijn, Johanna M; Geerlings, Maartje J; Pauper, Marc; Bakker, Bjorn; Amin, Najaf; Lores Motta, Laura; Kersten, Eveline; Garanto, Alejandro; Verlouw, Joost A M; van Rooij, Jeroen G J; Kraaij, Robert; de Jong, Paulus T V M; Hofman, Albert; Vingerling, Johannes R; Schick, Tina; Fauser, Sascha; de Jong, Eiko K; van Duijn, Cornelia M; Hoyng, Carel B; Klaver, Caroline C W; den Hollander, Anneke I. Whole-Exome Sequencing in Age-Related Macular Degeneration Identifies Rare Variants in COL8A1, a Component of Bruch's Membrane. Ophthalmology. 2018;125(9):1433-1443.