Anti COL20A1 pAb (ATL-HPA051962)

Atlas Antibodies

SKU:
ATL-HPA051962-25
  • Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells. Islets of Langerhans showed moderate cytoplasmic staining.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: collagen, type XX, alpha 1
Gene Name: COL20A1
Alternative Gene Name: KIAA1510
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016356: 79%, ENSRNOG00000010326: 78%
Entrez Gene ID: 57642
Uniprot ID: Q9P218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVSAIYAAGRSEAVSATGQTACPALRPDGSLPGFDLMVAFSLVEKAYASIRGVAMEPSAFGGTPTFTLFKDAQLTRRVSDVYPA
Gene Sequence LVSAIYAAGRSEAVSATGQTACPALRPDGSLPGFDLMVAFSLVEKAYASIRGVAMEPSAFGGTPTFTLFKDAQLTRRVSDVYPA
Gene ID - Mouse ENSMUSG00000016356
Gene ID - Rat ENSRNOG00000010326
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COL20A1 pAb (ATL-HPA051962)
Datasheet Anti COL20A1 pAb (ATL-HPA051962) Datasheet (External Link)
Vendor Page Anti COL20A1 pAb (ATL-HPA051962) at Atlas Antibodies

Documents & Links for Anti COL20A1 pAb (ATL-HPA051962)
Datasheet Anti COL20A1 pAb (ATL-HPA051962) Datasheet (External Link)
Vendor Page Anti COL20A1 pAb (ATL-HPA051962)