Anti COL13A1 pAb (ATL-HPA050392 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050392-25

• 
• 

Protein Description: collagen, type XIII, alpha 1
Gene Name: COL13A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058806: 95%, ENSRNOG00000000552: 95%
Entrez Gene ID: 1305
Uniprot ID: Q5TAT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLP
• Gene Sequence: KGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLP
• Gene ID - Mouse: ENSMUSG00000058806
• Gene ID - Rat: ENSRNOG00000000552
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.