Anti COL11A1 pAb (ATL-HPA058335)

Atlas Antibodies

SKU: ATL-HPA058335-25

• 

Protein Description: collagen, type XI, alpha 1
Gene Name: COL11A1
Alternative Gene Name: CO11A1, COLL6, STL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027966: 85%, ENSRNOG00000023148: 86%
Entrez Gene ID: 1301
Uniprot ID: P12107
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG
• Gene Sequence: DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG
• Gene ID - Mouse: ENSMUSG00000027966
• Gene ID - Rat: ENSRNOG00000023148
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.