Anti COIL pAb (ATL-HPA057480)
Atlas Antibodies
- SKU:
- ATL-HPA057480-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: COIL
Alternative Gene Name: CLN80, p80-coilin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033983: 81%, ENSRNOG00000000244: 79%
Entrez Gene ID: 8161
Uniprot ID: P38432
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDC |
Gene Sequence | ASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDC |
Gene ID - Mouse | ENSMUSG00000033983 |
Gene ID - Rat | ENSRNOG00000000244 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COIL pAb (ATL-HPA057480) | |
Datasheet | Anti COIL pAb (ATL-HPA057480) Datasheet (External Link) |
Vendor Page | Anti COIL pAb (ATL-HPA057480) at Atlas Antibodies |
Documents & Links for Anti COIL pAb (ATL-HPA057480) | |
Datasheet | Anti COIL pAb (ATL-HPA057480) Datasheet (External Link) |
Vendor Page | Anti COIL pAb (ATL-HPA057480) |