Anti COBLL1 pAb (ATL-HPA044933 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA044933-25
  • Immunohistochemistry analysis in human placenta and skeletal muscle tissues using HPA044933 antibody. Corresponding COBLL1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line RT4 shows localization to cell junctions.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cordon-bleu WH2 repeat protein-like 1
Gene Name: COBLL1
Alternative Gene Name: KIAA0977
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034903: 79%, ENSRNOG00000027016: 73%
Entrez Gene ID: 22837
Uniprot ID: Q53SF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNSAHNEQNSQIPTPTDGPSFTVMRQSSLTFQSSDPEQMRQSLLTAIRSGEAAAKLKRVTIPSNTISVNGRSRLSHSMSPD
Gene Sequence NNSAHNEQNSQIPTPTDGPSFTVMRQSSLTFQSSDPEQMRQSLLTAIRSGEAAAKLKRVTIPSNTISVNGRSRLSHSMSPD
Gene ID - Mouse ENSMUSG00000034903
Gene ID - Rat ENSRNOG00000027016
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti COBLL1 pAb (ATL-HPA044933 w/enhanced validation)
Datasheet Anti COBLL1 pAb (ATL-HPA044933 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COBLL1 pAb (ATL-HPA044933 w/enhanced validation)