Anti CNTN6 pAb (ATL-HPA016645)

Catalog No:
ATL-HPA016645-25
$447.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: contactin 6
Gene Name: CNTN6
Alternative Gene Name: NB-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030092: 86%, ENSRNOG00000032517: 84%
Entrez Gene ID: 27255
Uniprot ID: Q9UQ52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWKQNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQF
Gene Sequence TQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWKQNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQF
Gene ID - Mouse ENSMUSG00000030092
Gene ID - Rat ENSRNOG00000032517
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti CNTN6 pAb (ATL-HPA016645)
Datasheet Anti CNTN6 pAb (ATL-HPA016645) Datasheet (External Link)
Vendor Page Anti CNTN6 pAb (ATL-HPA016645) at Atlas

Documents & Links for Anti CNTN6 pAb (ATL-HPA016645)
Datasheet Anti CNTN6 pAb (ATL-HPA016645) Datasheet (External Link)
Vendor Page Anti CNTN6 pAb (ATL-HPA016645)