Protein Description: contactin 6
Gene Name: CNTN6
Alternative Gene Name: NB-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030092: 86%, ENSRNOG00000032517: 84%
Entrez Gene ID: 27255
Uniprot ID: Q9UQ52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CNTN6
Alternative Gene Name: NB-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030092: 86%, ENSRNOG00000032517: 84%
Entrez Gene ID: 27255
Uniprot ID: Q9UQ52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWKQNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQF |
| Documents & Links for Anti CNTN6 pAb (ATL-HPA016645) | |
| Datasheet | Anti CNTN6 pAb (ATL-HPA016645) Datasheet (External Link) |
| Vendor Page | Anti CNTN6 pAb (ATL-HPA016645) at Atlas |
| Documents & Links for Anti CNTN6 pAb (ATL-HPA016645) | |
| Datasheet | Anti CNTN6 pAb (ATL-HPA016645) Datasheet (External Link) |
| Vendor Page | Anti CNTN6 pAb (ATL-HPA016645) |