Anti CNTD2 pAb (ATL-HPA045615)

Atlas Antibodies

SKU: ATL-HPA045615-25

• 

Protein Description: cyclin N-terminal domain containing 2
Gene Name: CNTD2
Alternative Gene Name: CCNP, FLJ13265
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002341: 29%, ENSRNOG00000010918: 33%
Entrez Gene ID: 79935
Uniprot ID: Q9H8S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: SRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVM
• Gene ID - Mouse: ENSMUSG00000002341
• Gene ID - Rat: ENSMUSG00000002341
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.