Anti CNR1 pAb (ATL-HPA069945)

Catalog No:
ATL-HPA069945-25
$395.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: cannabinoid receptor 1
Gene Name: CNR1
Alternative Gene Name: CANN6, CB-R, CB1, CB1A, CB1K5, CNR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044288: 100%, ENSRNOG00000008223: 100%
Entrez Gene ID: 1268
Uniprot ID: P21554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence LWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKT
Gene ID - Mouse ENSMUSG00000044288
Gene ID - Rat ENSMUSG00000044288
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti CNR1 pAb (ATL-HPA069945)
Datasheet Anti CNR1 pAb (ATL-HPA069945) Datasheet (External Link)
Vendor Page Anti CNR1 pAb (ATL-HPA069945) at Atlas

Documents & Links for Anti CNR1 pAb (ATL-HPA069945)
Datasheet Anti CNR1 pAb (ATL-HPA069945) Datasheet (External Link)
Vendor Page Anti CNR1 pAb (ATL-HPA069945)