Anti CNP pAb (ATL-HPA023280 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023280-25

• 
• 
• 

Protein Description: 2',3'-cyclic nucleotide 3' phosphodiesterase
Gene Name: CNP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006782: 76%, ENSRNOG00000017496: 77%
Entrez Gene ID: 1267
Uniprot ID: P09543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITL
• Gene Sequence: PGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITL
• Gene ID - Mouse: ENSMUSG00000006782
• Gene ID - Rat: ENSRNOG00000017496
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CNP pAb (ATL-HPA023280 w/enhanced validation) – 1 Found

Gao, Yanpan; Liu, Jiaqi; Wang, Jiayu; Liu, Yifan; Zeng, Ling-Hui; Ge, Wei; Ma, Chao. Proteomic analysis of human hippocampal subfields provides new insights into the pathogenesis of Alzheimer's disease and the role of glial cells. Brain Pathology (Zurich, Switzerland). 2022;32(4):e13047.