Anti CNOT9 pAb (ATL-HPA046622)

Atlas Antibodies

SKU: ATL-HPA046622-25

• 

Protein Description: CCR4-NOT transcription complex subunit 9
Gene Name: CNOT9
Alternative Gene Name: CAF40, CT129, RCD1, RCD1+, RQCD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026174: 100%, ENSRNOG00000016034: 100%
Entrez Gene ID: 9125
Uniprot ID: Q92600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTS
• Gene Sequence: WHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTS
• Gene ID - Mouse: ENSMUSG00000026174
• Gene ID - Rat: ENSRNOG00000016034
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.