Anti CNOT8 pAb (ATL-HPA051398)
Atlas Antibodies
- SKU:
- ATL-HPA051398-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CNOT8
Alternative Gene Name: CAF1, CALIF, hCAF1, POP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020515: 95%, ENSRNOG00000002630: 97%
Entrez Gene ID: 9337
Uniprot ID: Q9UFF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ |
Gene Sequence | CGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ |
Gene ID - Mouse | ENSMUSG00000020515 |
Gene ID - Rat | ENSRNOG00000002630 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CNOT8 pAb (ATL-HPA051398) | |
Datasheet | Anti CNOT8 pAb (ATL-HPA051398) Datasheet (External Link) |
Vendor Page | Anti CNOT8 pAb (ATL-HPA051398) at Atlas Antibodies |
Documents & Links for Anti CNOT8 pAb (ATL-HPA051398) | |
Datasheet | Anti CNOT8 pAb (ATL-HPA051398) Datasheet (External Link) |
Vendor Page | Anti CNOT8 pAb (ATL-HPA051398) |