Anti CNOT8 pAb (ATL-HPA051398)

Atlas Antibodies

SKU: ATL-HPA051398-25

• 

Protein Description: CCR4-NOT transcription complex, subunit 8
Gene Name: CNOT8
Alternative Gene Name: CAF1, CALIF, hCAF1, POP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020515: 95%, ENSRNOG00000002630: 97%
Entrez Gene ID: 9337
Uniprot ID: Q9UFF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
• Gene Sequence: CGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
• Gene ID - Mouse: ENSMUSG00000020515
• Gene ID - Rat: ENSRNOG00000002630
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.