Anti CNOT1 pAb (ATL-HPA046577)

Atlas Antibodies

SKU: ATL-HPA046577-25

• 

Protein Description: CCR4-NOT transcription complex, subunit 1
Gene Name: CNOT1
Alternative Gene Name: AD-005, CDC39, KIAA1007, NOT1, NOT1H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036550: 100%, ENSRNOG00000012271: 100%
Entrez Gene ID: 23019
Uniprot ID: A5YKK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TIETLMRINAHSRGNAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVG
• Gene Sequence: TIETLMRINAHSRGNAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVG
• Gene ID - Mouse: ENSMUSG00000036550
• Gene ID - Rat: ENSRNOG00000012271
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CNOT1 pAb (ATL-HPA046577) – 1 Found

Dittmann, Klaus; Mayer, Claus; Czemmel, Stefan; Huber, Stephan M; Rodemann, H Peter. New roles for nuclear EGFR in regulating the stability and translation of mRNAs associated with VEGF signaling. Plos One. 12(12):e0189087.