Anti CNNM2 pAb (ATL-HPA059954)

Atlas Antibodies

SKU: ATL-HPA059954-100

• 
• 

Protein Description: cyclin and CBS domain divalent metal cation transport mediator 2
Gene Name: CNNM2
Alternative Gene Name: ACDP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064105: 98%, ENSRNOG00000020113: 98%
Entrez Gene ID: 54805
Uniprot ID: Q9H8M5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAFTEHE
• Gene Sequence: AVGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAFTEHE
• Gene ID - Mouse: ENSMUSG00000064105
• Gene ID - Rat: ENSRNOG00000020113
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.