Anti CNN3 pAb (ATL-HPA051237 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051237-25

• 
• 
• 

Protein Description: calponin 3, acidic
Gene Name: CNN3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053931: 93%, ENSRNOG00000011559: 92%
Entrez Gene ID: 1266
Uniprot ID: Q15417
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
• Gene Sequence: PKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
• Gene ID - Mouse: ENSMUSG00000053931
• Gene ID - Rat: ENSRNOG00000011559
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.