Anti CNKSR3 pAb (ATL-HPA049651)

Atlas Antibodies

SKU:
ATL-HPA049651-25
  • Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CNKSR family member 3
Gene Name: CNKSR3
Alternative Gene Name: FLJ31349, MAGI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015202: 93%, ENSRNOG00000018052: 92%
Entrez Gene ID: 154043
Uniprot ID: Q6P9H4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRYFSNERIP
Gene Sequence FLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRYFSNERIP
Gene ID - Mouse ENSMUSG00000015202
Gene ID - Rat ENSRNOG00000018052
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNKSR3 pAb (ATL-HPA049651)
Datasheet Anti CNKSR3 pAb (ATL-HPA049651) Datasheet (External Link)
Vendor Page Anti CNKSR3 pAb (ATL-HPA049651) at Atlas Antibodies

Documents & Links for Anti CNKSR3 pAb (ATL-HPA049651)
Datasheet Anti CNKSR3 pAb (ATL-HPA049651) Datasheet (External Link)
Vendor Page Anti CNKSR3 pAb (ATL-HPA049651)