Anti CNFN pAb (ATL-HPA053997)
Atlas Antibodies
- SKU:
- ATL-HPA053997-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CNFN
Alternative Gene Name: PLAC8L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063651: 98%, ENSRNOG00000020530: 98%
Entrez Gene ID: 84518
Uniprot ID: Q9BYD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIR |
Gene Sequence | FGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIR |
Gene ID - Mouse | ENSMUSG00000063651 |
Gene ID - Rat | ENSRNOG00000020530 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CNFN pAb (ATL-HPA053997) | |
Datasheet | Anti CNFN pAb (ATL-HPA053997) Datasheet (External Link) |
Vendor Page | Anti CNFN pAb (ATL-HPA053997) at Atlas Antibodies |
Documents & Links for Anti CNFN pAb (ATL-HPA053997) | |
Datasheet | Anti CNFN pAb (ATL-HPA053997) Datasheet (External Link) |
Vendor Page | Anti CNFN pAb (ATL-HPA053997) |