Anti CNEP1R1 pAb (ATL-HPA077906)

Atlas Antibodies

SKU: ATL-HPA077906-25

• 

Protein Description: CTD nuclear envelope phosphatase 1 regulatory subunit 1
Gene Name: CNEP1R1
Alternative Gene Name: C16orf69, FLJ38101, NEP1-R1, TMEM188
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036810: 100%, ENSRNOG00000015534: 100%
Entrez Gene ID: 255919
Uniprot ID: Q8N9A8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ
• Gene Sequence: HKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ
• Gene ID - Mouse: ENSMUSG00000036810
• Gene ID - Rat: ENSRNOG00000015534
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.