Anti CMTR2 pAb (ATL-HPA048265)
Atlas Antibodies
- SKU:
- ATL-HPA048265-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CMTR2
Alternative Gene Name: AFT, FLJ11171, FTSJD1, MTr2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046441: 76%, ENSRNOG00000017102: 75%
Entrez Gene ID: 55783
Uniprot ID: Q8IYT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DKVAKGYFNSWAEEHGVYHPGQSSILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPKQQYSCSCH |
| Gene Sequence | DKVAKGYFNSWAEEHGVYHPGQSSILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPKQQYSCSCH |
| Gene ID - Mouse | ENSMUSG00000046441 |
| Gene ID - Rat | ENSRNOG00000017102 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMTR2 pAb (ATL-HPA048265) | |
| Datasheet | Anti CMTR2 pAb (ATL-HPA048265) Datasheet (External Link) |
| Vendor Page | Anti CMTR2 pAb (ATL-HPA048265) at Atlas Antibodies |
| Documents & Links for Anti CMTR2 pAb (ATL-HPA048265) | |
| Datasheet | Anti CMTR2 pAb (ATL-HPA048265) Datasheet (External Link) |
| Vendor Page | Anti CMTR2 pAb (ATL-HPA048265) |
| Citations for Anti CMTR2 pAb (ATL-HPA048265) – 1 Found |
| Drazkowska, Karolina; Tomecki, Rafal; Warminski, Marcin; Baran, Natalia; Cysewski, Dominik; Depaix, Anaïs; Kasprzyk, Renata; Kowalska, Joanna; Jemielity, Jacek; Sikorski, Pawel J. 2'-O-Methylation of the second transcribed nucleotide within the mRNA 5' cap impacts the protein production level in a cell-specific manner and contributes to RNA immune evasion. Nucleic Acids Research. 2022;50(16):9051-9071. PubMed |