Anti CMTM5 pAb (ATL-HPA052338 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052338-25

• 
• 
• 

Protein Description: CKLF-like MARVEL transmembrane domain containing 5
Gene Name: CMTM5
Alternative Gene Name: CKLFSF5, FLJ37521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040759: 69%, ENSRNOG00000016828: 64%
Entrez Gene ID: 116173
Uniprot ID: Q96DZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGI
• Gene Sequence: MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGI
• Gene ID - Mouse: ENSMUSG00000040759
• Gene ID - Rat: ENSRNOG00000016828
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.