Anti CMPK1 pAb (ATL-HPA058604)

Atlas Antibodies

SKU: ATL-HPA058604-100

• 
• 

Protein Description: cytidine monophosphate (UMP-CMP) kinase 1, cytosolic
Gene Name: CMPK1
Alternative Gene Name: CMPK, UMP-CMPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028719: 100%, ENSRNOG00000007775: 100%
Entrez Gene ID: 51727
Uniprot ID: P30085
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDN
• Gene Sequence: LLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDN
• Gene ID - Mouse: ENSMUSG00000028719
• Gene ID - Rat: ENSRNOG00000007775
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.