Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053730-100

• 
• 
• 

Protein Description: cytidine monophosphate (UMP-CMP) kinase 1, cytosolic
Gene Name: CMPK1
Alternative Gene Name: CMPK, UMP-CMPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028719: 99%, ENSRNOG00000007775: 97%
Entrez Gene ID: 51727
Uniprot ID: P30085
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKK
• Gene Sequence: NLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKK
• Gene ID - Mouse: ENSMUSG00000028719
• Gene ID - Rat: ENSRNOG00000007775
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CMPK1 pAb (ATL-HPA053730 w/enhanced validation) – 1 Found

Ryu, Jae Yong; Kim, Hyun Uk; Lee, Sang Yup. Framework and resource for more than 11,000 gene-transcript-protein-reaction associations in human metabolism. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(45):E9740-E9749.