Anti CMC4 pAb (ATL-HPA045866)

Atlas Antibodies

SKU: ATL-HPA045866-25

• 
• 

Protein Description: C-x(9)-C motif containing 4
Gene Name: CMC4
Alternative Gene Name: MTCP1, MTCP1NB, p8, P8MTCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090110: 88%, ENSRNOG00000056435: 66%
Entrez Gene ID: 100272147
Uniprot ID: P56277
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
• Gene Sequence: MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
• Gene ID - Mouse: ENSMUSG00000090110
• Gene ID - Rat: ENSRNOG00000056435
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.