Anti CLTA pAb (ATL-HPA054667 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054667-25

• 

Protein Description: clathrin, light chain A
Gene Name: CLTA
Alternative Gene Name: Lca
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028478: 99%, ENSRNOG00000014635: 99%
Entrez Gene ID: 1211
Uniprot ID: P09496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERV
• Gene Sequence: LEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERV
• Gene ID - Mouse: ENSMUSG00000028478
• Gene ID - Rat: ENSRNOG00000014635
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.