Anti CLIP4 pAb (ATL-HPA056246)

Atlas Antibodies

SKU:
ATL-HPA056246-25
  • Immunofluorescent staining of human cell line HeLa shows localization to vesicles.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CAP-GLY domain containing linker protein family, member 4
Gene Name: CLIP4
Alternative Gene Name: FLJ21069, RSNL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024059: 88%, ENSRNOG00000008806: 52%
Entrez Gene ID: 79745
Uniprot ID: Q8N3C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRVQRVTDSLDTLSEISSNKQNHSYPGFRRSFSTTSASSQKEINRRNAFSKSKAALRRSWSSTPTAGGIEGSVKLHEGSQVLLTSSNEMGTV
Gene Sequence SRVQRVTDSLDTLSEISSNKQNHSYPGFRRSFSTTSASSQKEINRRNAFSKSKAALRRSWSSTPTAGGIEGSVKLHEGSQVLLTSSNEMGTV
Gene ID - Mouse ENSMUSG00000024059
Gene ID - Rat ENSRNOG00000008806
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CLIP4 pAb (ATL-HPA056246)
Datasheet Anti CLIP4 pAb (ATL-HPA056246) Datasheet (External Link)
Vendor Page Anti CLIP4 pAb (ATL-HPA056246) at Atlas Antibodies

Documents & Links for Anti CLIP4 pAb (ATL-HPA056246)
Datasheet Anti CLIP4 pAb (ATL-HPA056246) Datasheet (External Link)
Vendor Page Anti CLIP4 pAb (ATL-HPA056246)