Anti CLIC2 pAb (ATL-HPA047381)

Atlas Antibodies

SKU:
ATL-HPA047381-25
  • Immunofluorescent staining of human cell line ASC TERT1 shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chloride intracellular channel 2
Gene Name: CLIC2
Alternative Gene Name: XAP121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037242: 55%, ENSRNOG00000000728: 97%
Entrez Gene ID: 1193
Uniprot ID: O15247
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEQTLAPPRYPHLSPKYKESFDVGCNLFAKF
Gene Sequence LEQTLAPPRYPHLSPKYKESFDVGCNLFAKF
Gene ID - Mouse ENSMUSG00000037242
Gene ID - Rat ENSRNOG00000000728
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CLIC2 pAb (ATL-HPA047381)
Datasheet Anti CLIC2 pAb (ATL-HPA047381) Datasheet (External Link)
Vendor Page Anti CLIC2 pAb (ATL-HPA047381) at Atlas Antibodies

Documents & Links for Anti CLIC2 pAb (ATL-HPA047381)
Datasheet Anti CLIC2 pAb (ATL-HPA047381) Datasheet (External Link)
Vendor Page Anti CLIC2 pAb (ATL-HPA047381)