Anti CLGN pAb (ATL-HPA058627 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA058627-25

• 

Product Description

Protein Description: calmegin
Gene Name: CLGN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002190: 54%, ENSRNOG00000003755: 54%
Entrez Gene ID: 1047
Uniprot ID: O14967
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEML
• Gene Sequence: QTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEML
• Gene ID - Mouse: ENSMUSG00000002190
• Gene ID - Rat: ENSRNOG00000003755
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links