Anti CLEC7A pAb (ATL-HPA050229)

Atlas Antibodies

SKU: ATL-HPA050229-100

• 
• 

Protein Description: C-type lectin domain family 7, member A
Gene Name: CLEC7A
Alternative Gene Name: CD369, CLECSF12, dectin-1, hDectin-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061769: 35%, ENSRNOG00000054251: 56%
Entrez Gene ID: 64581
Uniprot ID: Q9BXN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFS
• Gene Sequence: DSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFS
• Gene ID - Mouse: ENSMUSG00000061769
• Gene ID - Rat: ENSRNOG00000054251
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.