Anti CLEC3A pAb (ATL-HPA051511)

Atlas Antibodies

SKU: ATL-HPA051511-25

• 

Protein Description: C-type lectin domain family 3, member A
Gene Name: CLEC3A
Alternative Gene Name: CLECSF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008874: 89%, ENSRNOG00000012238: 87%
Entrez Gene ID: 10143
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDR
• Gene Sequence: DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDR
• Gene ID - Mouse: ENSMUSG00000008874
• Gene ID - Rat: ENSRNOG00000012238
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.