Anti CLEC3A pAb (ATL-HPA051511)

Atlas Antibodies

SKU:
ATL-HPA051511-25
  • Immunohistochemical staining of human cerebral cortex shows strong granular pattern cytoplasmic positivity in neuronal cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: C-type lectin domain family 3, member A
Gene Name: CLEC3A
Alternative Gene Name: CLECSF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008874: 89%, ENSRNOG00000012238: 87%
Entrez Gene ID: 10143
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDR
Gene Sequence DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDR
Gene ID - Mouse ENSMUSG00000008874
Gene ID - Rat ENSRNOG00000012238
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CLEC3A pAb (ATL-HPA051511)
Datasheet Anti CLEC3A pAb (ATL-HPA051511) Datasheet (External Link)
Vendor Page Anti CLEC3A pAb (ATL-HPA051511) at Atlas Antibodies

Documents & Links for Anti CLEC3A pAb (ATL-HPA051511)
Datasheet Anti CLEC3A pAb (ATL-HPA051511) Datasheet (External Link)
Vendor Page Anti CLEC3A pAb (ATL-HPA051511)