Anti CLEC2A pAb (ATL-HPA048530)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048530-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CLEC2A
Alternative Gene Name: INPE5792, KACL, PILAR, UNQ5792
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030142: 43%, ENSRNOG00000037076: 53%
Entrez Gene ID: 387836
Uniprot ID: Q6UVW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DDTRNWTASKIFCSLQKAELAQIDTQEDME |
Gene Sequence | DDTRNWTASKIFCSLQKAELAQIDTQEDME |
Gene ID - Mouse | ENSMUSG00000030142 |
Gene ID - Rat | ENSRNOG00000037076 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CLEC2A pAb (ATL-HPA048530) | |
Datasheet | Anti CLEC2A pAb (ATL-HPA048530) Datasheet (External Link) |
Vendor Page | Anti CLEC2A pAb (ATL-HPA048530) at Atlas Antibodies |
Documents & Links for Anti CLEC2A pAb (ATL-HPA048530) | |
Datasheet | Anti CLEC2A pAb (ATL-HPA048530) Datasheet (External Link) |
Vendor Page | Anti CLEC2A pAb (ATL-HPA048530) |