Anti CLDN9 pAb (ATL-HPA076613)

Catalog No:
ATL-HPA076613-25
$303.00
Protein Description: claudin 9
Gene Name: CLDN9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066720: 92%, ENSRNOG00000003654: 92%
Entrez Gene ID: 9080
Uniprot ID: O95484
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence GLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
Gene ID - Mouse ENSMUSG00000066720
Gene ID - Rat ENSMUSG00000066720
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti CLDN9 pAb (ATL-HPA076613)
Datasheet Anti CLDN9 pAb (ATL-HPA076613) Datasheet (External Link)
Vendor Page Anti CLDN9 pAb (ATL-HPA076613) at Atlas

Documents & Links for Anti CLDN9 pAb (ATL-HPA076613)
Datasheet Anti CLDN9 pAb (ATL-HPA076613) Datasheet (External Link)
Vendor Page Anti CLDN9 pAb (ATL-HPA076613)