Protein Description: claudin 9
Gene Name: CLDN9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066720: 92%, ENSRNOG00000003654: 92%
Entrez Gene ID: 9080
Uniprot ID: O95484
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CLDN9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066720: 92%, ENSRNOG00000003654: 92%
Entrez Gene ID: 9080
Uniprot ID: O95484
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV |
| Documents & Links for Anti CLDN9 pAb (ATL-HPA076613) | |
| Datasheet | Anti CLDN9 pAb (ATL-HPA076613) Datasheet (External Link) |
| Vendor Page | Anti CLDN9 pAb (ATL-HPA076613) at Atlas |
| Documents & Links for Anti CLDN9 pAb (ATL-HPA076613) | |
| Datasheet | Anti CLDN9 pAb (ATL-HPA076613) Datasheet (External Link) |
| Vendor Page | Anti CLDN9 pAb (ATL-HPA076613) |