Anti CLCA1 pAb (ATL-HPA052787 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052787-25

• 

Protein Description: chloride channel accessory 1
Gene Name: CLCA1
Alternative Gene Name: CaCC, CLCRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028255: 81%, ENSRNOG00000060831: 80%
Entrez Gene ID: 1179
Uniprot ID: A8K7I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGMVTFDSAAHVQSELIQINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVIRKKYPTDGSEIVLLTD
• Gene Sequence: VGMVTFDSAAHVQSELIQINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVIRKKYPTDGSEIVLLTD
• Gene ID - Mouse: ENSMUSG00000028255
• Gene ID - Rat: ENSRNOG00000060831
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.