Anti CKMT2 pAb (ATL-HPA051880 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051880-25

• 

Protein Description: creatine kinase, mitochondrial 2 (sarcomeric)
Gene Name: CKMT2
Alternative Gene Name: SMTCK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021622: 84%, ENSRNOG00000055450: 79%
Entrez Gene ID: 1160
Uniprot ID: P17540
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDL
• Gene Sequence: ASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDL
• Gene ID - Mouse: ENSMUSG00000021622
• Gene ID - Rat: ENSRNOG00000055450
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.