Protein Description: capicua transcriptional repressor
Gene Name: CIC
Alternative Gene Name: KIAA0306
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005442: 96%, ENSRNOG00000056118: 96%
Entrez Gene ID: 23152
Uniprot ID: Q96RK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CIC
Alternative Gene Name: KIAA0306
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005442: 96%, ENSRNOG00000056118: 96%
Entrez Gene ID: 23152
Uniprot ID: Q96RK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MYSAHRPLMPASSAASRGLGMFVWTNVEPRSVAVFPWHSLVPFLAPSQPDPSVQPSEAQQPASHPVASNQSKEPAESAAVAHERP |
| Documents & Links for Anti CIC pAb (ATL-HPA064725) | |
| Datasheet | Anti CIC pAb (ATL-HPA064725) Datasheet (External Link) |
| Vendor Page | Anti CIC pAb (ATL-HPA064725) at Atlas |
| Documents & Links for Anti CIC pAb (ATL-HPA064725) | |
| Datasheet | Anti CIC pAb (ATL-HPA064725) Datasheet (External Link) |
| Vendor Page | Anti CIC pAb (ATL-HPA064725) |