Anti CHTF8 pAb (ATL-HPA051872)

Atlas Antibodies

SKU:
ATL-HPA051872-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae)
Gene Name: CHTF8
Alternative Gene Name: CTF8, DERPC, FLJ20400
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046691: 82%, ENSRNOG00000003897: 34%
Entrez Gene ID: 54921
Uniprot ID: P0CG12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PIGPNSAHFSRPVGPMGVNANPFPRGAGSSAFSQSSGTLASNPATFQRSAGLQGSNPTIFPRASGPLGPNPANFPRAT
Gene Sequence PIGPNSAHFSRPVGPMGVNANPFPRGAGSSAFSQSSGTLASNPATFQRSAGLQGSNPTIFPRASGPLGPNPANFPRAT
Gene ID - Mouse ENSMUSG00000046691
Gene ID - Rat ENSRNOG00000003897
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHTF8 pAb (ATL-HPA051872)
Datasheet Anti CHTF8 pAb (ATL-HPA051872) Datasheet (External Link)
Vendor Page Anti CHTF8 pAb (ATL-HPA051872) at Atlas Antibodies

Documents & Links for Anti CHTF8 pAb (ATL-HPA051872)
Datasheet Anti CHTF8 pAb (ATL-HPA051872) Datasheet (External Link)
Vendor Page Anti CHTF8 pAb (ATL-HPA051872)