Protein Description: carbohydrate sulfotransferase 5
Gene Name: CHST5
Alternative Gene Name: FLJ22167, I-GLCNAC-6-ST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031952: 81%, ENSRNOG00000021521: 79%
Entrez Gene ID: 23563
Uniprot ID: Q9GZS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHST5
Alternative Gene Name: FLJ22167, I-GLCNAC-6-ST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031952: 81%, ENSRNOG00000021521: 79%
Entrez Gene ID: 23563
Uniprot ID: Q9GZS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | YRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGS |
Documents & Links for Anti CHST5 pAb (ATL-HPA068029) | |
Datasheet | Anti CHST5 pAb (ATL-HPA068029) Datasheet (External Link) |
Vendor Page | Anti CHST5 pAb (ATL-HPA068029) at Atlas |
Documents & Links for Anti CHST5 pAb (ATL-HPA068029) | |
Datasheet | Anti CHST5 pAb (ATL-HPA068029) Datasheet (External Link) |
Vendor Page | Anti CHST5 pAb (ATL-HPA068029) |