Protein Description: cholinergic receptor nicotinic delta subunit
Gene Name: CHRND
Alternative Gene Name: ACHRD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026251: 83%, ENSRNOG00000019527: 87%
Entrez Gene ID: 1144
Uniprot ID: Q07001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHRND
Alternative Gene Name: ACHRD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026251: 83%, ENSRNOG00000019527: 87%
Entrez Gene ID: 1144
Uniprot ID: Q07001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEET |
| Documents & Links for Anti CHRND pAb (ATL-HPA065404) | |
| Datasheet | Anti CHRND pAb (ATL-HPA065404) Datasheet (External Link) |
| Vendor Page | Anti CHRND pAb (ATL-HPA065404) at Atlas |
| Documents & Links for Anti CHRND pAb (ATL-HPA065404) | |
| Datasheet | Anti CHRND pAb (ATL-HPA065404) Datasheet (External Link) |
| Vendor Page | Anti CHRND pAb (ATL-HPA065404) |